HORDB

ID: hor001497
Uniprot ID: P41855
Protein name: SADPNFLRF-amide
Gene name: flp-1
Organism: Caenorhabditis elegans
Family: FARP (FMRFamide related peptide) family
Source: animal
Expression: Each flp gene is expressed in a distinct set of neurons. Flp-1 is expressed in the AVA interneurons, the M5 cholinergic pharyngeal motoneurons, and the AIA, AIY, AVE, AVK, RIG and RMG neurons.
Disease: NA
Comments: NA
Taxonomy: Caenorhabditis (genus), Peloderinae (subfamily), Rhabditidae (family), Rhabditoidea (superfamily), Rhabditomorpha (infraorder), Rhabditina (suborder), Rhabditida (order), Chromadorea (class), Nematoda (phylum), Ecdysozoa, Protostomia, Bilateria, Eumetazoa, Metazoa (kingdom), Opisthokonta, Eukaryota (superkingdom), cellular organisms
GO MF: GO:0071855 neuropeptide receptor binding
GO BP: GO:0006937 regulation of muscle contraction; GO:0006972 hyperosmotic response; GO:0007218 neuropeptide signaling pathway; GO:0007626 locomotory behavior; GO:0007638 mechanosensory behavior; GO:0046662 regulation of egg-laying behavior; GO:1904014 response to serotonin
GO CC: GO:0005576 extracellular region

Sequence: SADPNFLRF
Length: 9
Propeptide: MTLLYQVGLLLLVAATYKVSAECCTPGATSDFCTVFSMLSTMEQNEVMNFIGENCDGDAEVALQKMEKRKPNFMRYGRSAAVKSLGKKAGSDPNFLRFGRSQPNFLRFGKASGDPNFLRFGRSDPNFLRFGKAAADPNFLRFGKRSADPNFLRFGRSFDNFDRESRKPNFLRFGK
Signal peptide: MTLLYQVGLLLLVAATYKVSA
Modification: T9 Phenylalanine amide
Glycosylation: NA
Mutagenesis: NA

Function: Inhibits the activity of dissected pharyngeal myogenic muscle system.
Mechanism: [Isoform b]: Expressed at about a twofold higher level than isoform Long.
Cross BBB: NA
Target: NA
Target Unid: NA
IC50: NA
EC50: NA
ED50: NA
kd: NA
Half life: NA

Structure: (PDB_ID-from https://www.rcsb.org/; AlphaFold_DB_ID-from https://alphafold.ebi.ac.uk/; hordbxxxxxx_AF2.pdb was predicted structure by AlphaFold2; hordbxxxxxx_ESM.pdb was predicted structure by ESMFold)

hor001497_AF2.pdb

hor001497_ESM.pdb

Mass:	120905	Formula:	C49H71N13O14
Absent amino acids:	CEGHIKMQTVWY	Common amino acids:	F
pI:	6.34	Basic residues:	1
Polar residues:	2	Hydrophobic residues:	4
Hydrophobicity:	-30	Boman Index:	-2099
Half-Life:	1.9 hour	Half-Life Yeast:	>20 hour
Half-Life E.Coli:	>10 hour	Aliphatic Index	54.44
Instability Index:	415.56	Extinction Coefficient cystines:	0
Absorbance 280nm:	0

PubMed ID: 8483810
Title: Discovering Neuropeptides in Caenorhabditis Elegans by Two Dimensional Liquid Chromatography and Mass Spectrometry.
PubMed ID: 16061202
Title: Discovering Neuropeptides in Caenorhabditis Elegans by Two Dimensional Liquid Chromatography and Mass Spectrometry